SAAL1 antibody (70R-4570)

Rabbit polyclonal SAAL1 antibody raised against the N terminal of SAAL1

Synonyms Polyclonal SAAL1 antibody, Anti-SAAL1 antibody, FLJ41463 antibody, Serum Amyloid A-Like 1 antibody
Specificity SAAL1 antibody was raised against the N terminal of SAAL1
Cross Reactivity Human
Applications WB
Immunogen SAAL1 antibody was raised using the N terminal of SAAL1 corresponding to a region with amino acids MDRNPSPPPPGRDKEEEEEVAGGDCIGSTVYSKHWLFGVLSGLIQIVSPE
Assay Information SAAL1 Blocking Peptide, catalog no. 33R-5867, is also available for use as a blocking control in assays to test for specificity of this SAAL1 antibody


Western Blot analysis using SAAL1 antibody (70R-4570)

SAAL1 antibody (70R-4570) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SAAL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The SAAL1 protein may be involved in binding.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SAAL1 antibody (70R-4570) | SAAL1 antibody (70R-4570) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors