SAC antibody (70R-5971)

Rabbit polyclonal SAC antibody raised against the N terminal Of Sac

Synonyms Polyclonal SAC antibody, Anti-SAC antibody, SACI antibody, HCA2 antibody, RP1-313L4.2 antibody
Specificity SAC antibody was raised against the N terminal Of Sac
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SAC antibody was raised using the N terminal Of Sac corresponding to a region with amino acids VGHTVRHEYTVIGQKVNLAARMMMYYPGIVTCDSVTYNGSNLPAYFFKEL
Assay Information SAC Blocking Peptide, catalog no. 33R-9558, is also available for use as a blocking control in assays to test for specificity of this SAC antibody

Images

Western Blot analysis using SAC antibody (70R-5971)

SAC antibody (70R-5971) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 187 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SAC antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SAC belongs to a distinct class of mammalian adenylyl cyclase that is soluble and insensitive to G protein or forskolin regulation. It is localized in the cytoplasm and is thought to function as a general bicarbonate sensor throughout the body. It may also play an important role in the generation of cAMP in spermatozoa, implying possible roles in sperm maturation through the epididymis, capacitation, hypermotility, and/or the acrosome reaction.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SAC antibody (70R-5971) | SAC antibody (70R-5971) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors