SAMD4A antibody (70R-3739)

Rabbit polyclonal SAMD4A antibody raised against the middle region of SAMD4A

Synonyms Polyclonal SAMD4A antibody, Anti-SAMD4A antibody, SMG antibody, SAMDA 4, Smaug1 antibody, SMGA antibody, SAMDA-4 antibody, SAMDA 4 antibody, DKFZp434H0350 antibody, KIAA1053 antibody, Smaug antibody, SAMD4 antibody, Sterile Alpha Motif Domain Containing 4A antibody, SAMD4A, SAMDA-4
Specificity SAMD4A antibody was raised against the middle region of SAMD4A
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SAMD4A antibody was raised using the middle region of SAMD4A corresponding to a region with amino acids LKSLRLHKYAALFSQMTYEEMMALTECQLEAQNVTKGARHKIVISIQKLK
Assay Information SAMD4A Blocking Peptide, catalog no. 33R-5106, is also available for use as a blocking control in assays to test for specificity of this SAMD4A antibody

Images

Western Blot analysis using SAMD4A antibody (70R-3739)

SAMD4A antibody (70R-3739) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 79 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SAMD4A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Sterile alpha motifs (SAMs) in proteins such as SAMD4A are part of an RNA-binding domain that functions as a posttranscriptional regulator by binding to an RNA sequence motif known as the Smaug recognition element, which was named after the Drosophila Smaug protein.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SAMD4A antibody (70R-3739) | SAMD4A antibody (70R-3739) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors