SAMD8 antibody (70R-7056)

Rabbit polyclonal SAMD8 antibody raised against the middle region of SAMD8

Synonyms Polyclonal SAMD8 antibody, Anti-SAMD8 antibody, SMSr antibody, SAMD-8, SAMD-8 antibody, SAMD 8 antibody, SAMD8, FLJ25082 antibody, SAMD 8, Sterile Alpha Motif Domain Containing 8 antibody
Specificity SAMD8 antibody was raised against the middle region of SAMD8
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SAMD8 antibody was raised using the middle region of SAMD8 corresponding to a region with amino acids MQTYPPLPDIFLDSVPRIPWAFAMTEVCGMILCYIWLLVLLLHKHRSILL
Assay Information SAMD8 Blocking Peptide, catalog no. 33R-6349, is also available for use as a blocking control in assays to test for specificity of this SAMD8 antibody

Images

Western Blot analysis using SAMD8 antibody (70R-7056)

SAMD8 antibody (70R-7056) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SAMD8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SAMD8 is a multi-pass membrane protein. It belongs to the sphingomyelin synthase family and contains 1 SAM (sterile alpha motif) domain. The function of the SAMD8 protein remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SAMD8 antibody (70R-7056) | SAMD8 antibody (70R-7056) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors