SAMHD1 antibody (70R-5844)

Rabbit polyclonal SAMHD1 antibody raised against the middle region of SAMHD1

Synonyms Polyclonal SAMHD1 antibody, Anti-SAMHD1 antibody, SAMHD 1 antibody, SAMHD 1, SAMHD1, DCIP antibody, SAMHD-1 antibody, SAMHD-1, MOP-5 antibody, Sam Domain And Hd Domain 1 antibody, SBBI88 antibody, HDDC1 antibody
Specificity SAMHD1 antibody was raised against the middle region of SAMHD1
Cross Reactivity Human,Mouse
Applications WB
Immunogen SAMHD1 antibody was raised using the middle region of SAMHD1 corresponding to a region with amino acids KGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNNFDYKRFIKF
Assay Information SAMHD1 Blocking Peptide, catalog no. 33R-4405, is also available for use as a blocking control in assays to test for specificity of this SAMHD1 antibody

Images

Western Blot analysis using SAMHD1 antibody (70R-5844)

SAMHD1 antibody (70R-5844) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 72 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SAMHD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SAMHD1 contains 1 HD domain and 1 SAM (sterile alpha motif) domain. SAMHD1 may play a role in mediating proinflammatory responses to TNF-alpha signaling.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SAMHD1 antibody (70R-5844) | SAMHD1 antibody (70R-5844) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors