Sarcospan antibody (70R-6112)

Rabbit polyclonal Sarcospan antibody

Synonyms Polyclonal Sarcospan antibody, Anti-Sarcospan antibody, KRAG antibody, SPN2 antibody, SSPN antibody, SPN1 antibody, Kras Oncogene-Associated Gene antibody
Cross Reactivity Human
Applications WB
Immunogen Sarcospan antibody was raised using a synthetic peptide corresponding to a region with amino acids AHHYSQLTQFTCETTLDSCQCKLPSSEPLSRTFVYRDVTDCTSVTGTFKL
Assay Information Sarcospan Blocking Peptide, catalog no. 33R-1245, is also available for use as a blocking control in assays to test for specificity of this Sarcospan antibody

Images

Western Blot analysis using Sarcospan antibody (70R-6112)

Sarcospan antibody (70R-6112) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SSPN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SSPN is a member of the dystrophin-glycoprotein complex (DGC). The DGC spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells.SSPN gene is expressed in a variety of tissues with highest levels in muscle, where alternative splice variants have been observed. In certain tumors KRAS2, SSPN, and ITPR2 are coamplified. The function of this gene is unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Sarcospan antibody (70R-6112) | Sarcospan antibody (70R-6112) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors