SARDH antibody (70R-1188)

Rabbit polyclonal SARDH antibody raised against the middle region of SARDH

Synonyms Polyclonal SARDH antibody, Anti-SARDH antibody, SARD antibody, Sarcosine Dehydrogenase antibody, DMGDHL1 antibody, SDH antibody, SAR antibody, FLJ36475 antibody
Specificity SARDH antibody was raised against the middle region of SARDH
Cross Reactivity Human, Mouse, Rat, Dog, ZebraFish
Applications IHC, WB
Immunogen SARDH antibody was raised using the middle region of SARDH corresponding to a region with amino acids DHPRWIRERSHESYAKNYSVVFPHDEPLAGRNMRRDPLHEELLGQGCVFQ
Assay Information SARDH Blocking Peptide, catalog no. 33R-1982, is also available for use as a blocking control in assays to test for specificity of this SARDH antibody


Immunohistochemical staining using SARDH antibody (70R-1188)

SARDH antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 67 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SARDH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is an enzyme localized to the mitochondrial matrix which catalyzes the oxidative demethylation of sarcosine. This enzyme is distinct from another mitochondrial matrix enzyme, dimethylglycine dehydrogenase, which catalyzes a reaction resulting in the formation of sarcosine. Mutations in this gene are associated with sarcosinemia.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using SARDH antibody (70R-1188) | SARDH antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using SARDH antibody (70R-1188) | SARDH antibody (70R-1188) used at 2.5 ug/ml to detect target protein.
  • Immunohistochemical staining using SARDH antibody (70R-1188) | SARDH antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors