SARS antibody (70R-1444)

Rabbit polyclonal SARS antibody raised against the C terminal of SARS

Synonyms Polyclonal SARS antibody, Anti-SARS antibody, Seryl-tRNA Synthetase antibody
Specificity SARS antibody was raised against the C terminal of SARS
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen SARS antibody was raised using the C terminal of SARS corresponding to a region with amino acids PEKLKEFMPPGLQELIPFVKPAPIEQEPSKKQKKQHEGSKKKAAARDVTL
Assay Information SARS Blocking Peptide, catalog no. 33R-7048, is also available for use as a blocking control in assays to test for specificity of this SARS antibody


Western Blot analysis using SARS antibody (70R-1444)

SARS antibody (70R-1444) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SARS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SARS belongs to the class II amino-acyl tRNA family. The enzyme catalyzes the transfer of L-serine to tRNA (Ser) and is related to bacterial and yeast counterparts.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SARS antibody (70R-1444) | SARS antibody (70R-1444) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors