SASP antibody (70R-3449)

Rabbit polyclonal SASP antibody raised against the middle region of Sasp

Synonyms Polyclonal SASP antibody, Anti-SASP antibody, Taps antibody, SASPase antibody, MUNO antibody
Specificity SASP antibody was raised against the middle region of Sasp
Cross Reactivity Human
Applications WB
Immunogen SASP antibody was raised using the middle region of Sasp corresponding to a region with amino acids RGEALGVYNRLSPQDQGDYGTVKEALLKAFGVPGAAPSHLPKEIVFANSM
Assay Information SASP Blocking Peptide, catalog no. 33R-7921, is also available for use as a blocking control in assays to test for specificity of this SASP antibody


Western Blot analysis using SASP antibody (70R-3449)

SASP antibody (70R-3449) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SASP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of SASP is not yet known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SASP antibody (70R-3449) | SASP antibody (70R-3449) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors