SC5DL antibody (70R-6978)

Rabbit polyclonal SC5DL antibody

Synonyms Polyclonal SC5DL antibody, Anti-SC5DL antibody, SC5DL, SCDL-5, S5DES antibody, Erg3 Delta-5-Desaturase Homolog S. Cerevisiae-Like antibody, SCDL 5, SCDL-5 antibody, Sterol-C5-Desaturase antibody, SC5D antibody, ERG3 antibody, SCDL 5 antibody
Cross Reactivity Human
Applications WB
Immunogen SC5DL antibody was raised using a synthetic peptide corresponding to a region with amino acids NQVRREIKFTVQALPWISILTVALFLLEIRGYSKLHDDLGEFPYGLFELV
Assay Information SC5DL Blocking Peptide, catalog no. 33R-6850, is also available for use as a blocking control in assays to test for specificity of this SC5DL antibody

Images

Western blot analysis using SC5DL antibody (70R-6978)

Recommended SC5DL Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SC5DL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes an enzyme of cholesterol biosynthesis. The encoded protein catalyzes the conversion of lathosterol into 7-dehydrocholesterol. Mutations in this gene have been associated with lathosterolosis. Alternatively spliced transcript variants encoding the same protein have been described.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using SC5DL antibody (70R-6978) | Recommended SC5DL Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors