SCARB2 Blocking Peptide (33R-10420)

A synthetic peptide for use as a blocking control in assays to test for specificity of SCARB2 antibody, catalog no. 70R-10351

Synonyms SCARB2 control peptide, SCARB2 antibody Blocking Peptide, Anti-SCARB2 Blocking Peptide, scavenger receptor class B, member 2 Blocking Peptide, AMRF Blocking Peptide, CD36L2 Blocking Peptide, HLGP85 Blocking Peptide, LIMPII Blocking Peptide, SR-BII Blocking Peptide, SCARB2, SCARB-2, SCARB 2, SCARB-2 Blocking Peptide, SCARB 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues VARVFQKAVDQSIEKKIVLRNGTEAFDSWEKPPLPVYTQFYFFNVTNPEE
Molecular Weight 53 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a type III glycoprotein that is located primarily in limiting membranes of lysosomes and endosomes. Earlier studies in mice and rat suggested that this protein may participate in membrane transportation and the reorganization of endosomal/lysosomal compartment. The protein deficiency in mice was reported to impair cell membrane transport processes and cause pelvic junction obstruction, deafness, and peripheral neuropathy. Further studies in human showed that this protein is a ubiquitously expressed protein and that it is involved in the pathogenesis of HFMD (hand, foot, and mouth disease) caused by enterovirus-71 and possibly by coxsackievirus A16. Mutations in this gene caused an autosomal recessive progressive myoclonic epilepsy-4 (EPM4), also known as action myoclonus-renal failure syndrome (AMRF).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors