SCCPDH antibody (70R-7071)

Rabbit polyclonal SCCPDH antibody

Synonyms Polyclonal SCCPDH antibody, Anti-SCCPDH antibody, Saccharopine Dehydrogenase antibody, CGI-49 antibody, RP11-439E19.2 antibody, FLJ43187 antibody
Cross Reactivity Human
Applications WB
Immunogen SCCPDH antibody was raised using a synthetic peptide corresponding to a region with amino acids FSFGYFSKQGPTQKQIDAASFTLTFFGQGYSQGTGTDKNKPNIKICTQVK
Assay Information SCCPDH Blocking Peptide, catalog no. 33R-3057, is also available for use as a blocking control in assays to test for specificity of this SCCPDH antibody

Images

Western Blot analysis using SCCPDH antibody (70R-7071)

SCCPDH antibody (70R-7071) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SCCPDH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SCCPDH belongs to the saccharopine dehydrogenase family. The exact function of SCCPDH remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SCCPDH antibody (70R-7071) | SCCPDH antibody (70R-7071) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors