SCG2 antibody (70R-4481)

Rabbit polyclonal SCG2 antibody

Synonyms Polyclonal SCG2 antibody, Anti-SCG2 antibody, Secretogranin Ii antibody, SCG 2 antibody, SCG-2, Chromogranin C antibody, SCG 2, CHGC antibody, SN antibody, SCG2, SgII antibody, SCG-2 antibody
Cross Reactivity Human
Applications WB
Immunogen SCG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KEESSPDYNPYQGVSVPLQQKENGDESHLPERDSLSEEDWMRIILEALRQ
Assay Information SCG2 Blocking Peptide, catalog no. 33R-4330, is also available for use as a blocking control in assays to test for specificity of this SCG2 antibody


Western Blot analysis using SCG2 antibody (70R-4481)

SCG2 antibody (70R-4481) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 71 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SCG2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. Studies in rodents suggest that the full-length protein, secretogranin II, is involved in the packaging or sorting of peptide hormones and neuropeptides into secretory vesicles. The full-length protein is cleaved to produce the active peptide secretoneurin, which exerts chemotaxic effects on specific cell types, and EM66, whose function is unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SCG2 antibody (70R-4481) | SCG2 antibody (70R-4481) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors