SCN5A antibody (70R-5111)

Rabbit polyclonal SCN5A antibody raised against the N terminal of SCN5A

Synonyms Polyclonal SCN5A antibody, Anti-SCN5A antibody, CDCD2 antibody, SCNA-5, PFHB1 antibody, CMD1E antibody, SCNA-5 antibody, SCNA 5, CMPD2 antibody, HB1 antibody, Nav1.5 antibody, ICCD antibody, SCNA 5 antibody, SCN5A, Sodium Channel Voltage-Gated Type V Alpha Subunit antibody, IVF antibody, SSS1 antibody, LQT3 antibody, HH1 antibody, HB2 antibody, HBBD antibody
Specificity SCN5A antibody was raised against the N terminal of SCN5A
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SCN5A antibody was raised using the N terminal of SCN5A corresponding to a region with amino acids SEADFADDENSTAGESESHHTSLLVPWPLRRTSAQGQPSPGTSAPGHALH
Assay Information SCN5A Blocking Peptide, catalog no. 33R-8381, is also available for use as a blocking control in assays to test for specificity of this SCN5A antibody

Images

Western Blot analysis using SCN5A antibody (70R-5111)

SCN5A antibody (70R-5111) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 227 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SCN5A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SCN5A is an integral membrane protein and tetrodotoxin-resistant voltage-gated sodium channel subunit. The protein is found primarily in cardiac muscle and is responsible for the initial upstroke of the action potential in an electrocardiogram.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SCN5A antibody (70R-5111) | SCN5A antibody (70R-5111) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors