SCN5A antibody (70R-5112)

Rabbit polyclonal SCN5A antibody raised against the C terminal of SCN5A

Synonyms Polyclonal SCN5A antibody, Anti-SCN5A antibody, SCNA-5, CMD1E antibody, Sodium Channel Voltage-Gated Type V Alpha Subunit antibody, Nav1.5 antibody, SCN5A, IVF antibody, HB2 antibody, CMPD2 antibody, LQT3 antibody, HB1 antibody, CDCD2 antibody, HH1 antibody, SCNA-5 antibody, SCNA 5 antibody, SSS1 antibody, SCNA 5
Specificity SCN5A antibody was raised against the C terminal of SCN5A
Cross Reactivity Human, Mouse, Rat, Dog, ZebraFish
Applications IHC, WB
Immunogen SCN5A antibody was raised using the C terminal of SCN5A corresponding to a region with amino acids FTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAM
Assay Information SCN5A Blocking Peptide, catalog no. 33R-3093, is also available for use as a blocking control in assays to test for specificity of this SCN5A antibody

Images

Western Blot analysis using SCN5A antibody (70R-5112)

SCN5A antibody (70R-5112) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 222 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SCN5A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SCN5A is an integral membrane protein and tetrodotoxin-resistant voltage-gated sodium channel subunit. The protein is found primarily in cardiac muscle and is responsible for the initial upstroke of the action potential in an electrocardiogram.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SCN5A antibody (70R-5112) | SCN5A antibody (70R-5112) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors