SCO1 antibody (70R-2321)

Rabbit polyclonal SCO1 antibody

Synonyms Polyclonal SCO1 antibody, Anti-SCO1 antibody, Sco Cytochrome Oxidase Deficient Homolog 1 antibody, SCO-1 antibody, SCOD1 antibody, SCO-1, SCO1, SCO 1 antibody, SCO 1
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen SCO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALLAGMKHVKKEKAEKLEKERQRHIGKPLLGGPFSLTTHTGERKTDKDYL
Assay Information SCO1 Blocking Peptide, catalog no. 33R-1346, is also available for use as a blocking control in assays to test for specificity of this SCO1 antibody


Western Blot analysis using SCO1 antibody (70R-2321)

SCO1 antibody (70R-2321) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SCO1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Mammalian cytochrome c oxidase (COX) catalyzes the transfer of reducing equivalents from cytochrome c to molecular oxygen and pumps protons across the inner mitochondrial membrane.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here
Submitted By
Application product used in Western Blotting
Usage 1:1000
Comments Pieces of whole liver from liver-specific Sco1 knockout mice (SCO1liv/liv) and wild-type littermates (SCO1wt/wt) were extracted in RIPA buffer (50 mM Tris [pH 7.4], 150 mM NaCl, 1% Triton X-100, 0.5% deoxycholate and 0.1% sodium dodecyl sulfate) in the presence of a complete protease inhibitor cocktail.

Samples were denatured for 10 minutes at 37°C in Laemmli buffer containing 100 mM dithiothreitol, and 20 μg of total protein was separated by SDS-PAGE on a 4-20% Tris-HCl gel. Following semi-dry transfer, the membrane was blocked for a minimum of 4 hours at room temperature in 20 mM Tris (pH 7.4), 135 mM sodium chloride and 0.05% Tween-20 (TBST) supplemented with 5% milk, and incubated overnight at 4°C in blocking buffer containing SCO1 antibody at a 1:1000 dilution.

The membrane was then washed with blocking buffer for 60 minutes, incubated for 1 hour at room temperature in blocking buffer containing secondary antibody, and washed again with blocking buffer for 60 minutes. Finally, the membrane was washed 3 times in TBST, and developed by enhanced chemiluminescence. An immunoreactive band at the expected molecular weight of SCO1 was detectable in the SCO1wt/wt extract but not in the SCO1liv/liv extract.
Rating 5


  • Western Blot analysis using SCO1 antibody (70R-2321) | SCO1 antibody (70R-2321) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors