SCOTIN antibody (70R-5982)

Rabbit polyclonal SCOTIN antibody raised against the middle region of Scotin

Synonyms Polyclonal SCOTIN antibody, Anti-SCOTIN antibody
Specificity SCOTIN antibody was raised against the middle region of Scotin
Cross Reactivity Human
Applications WB
Immunogen SCOTIN antibody was raised using the middle region of Scotin corresponding to a region with amino acids CAVPEASVPASVEPVEQLGSALRFRPGYNDPMSGFGATLAVGLTIFVLSV
Assay Information SCOTIN Blocking Peptide, catalog no. 33R-1648, is also available for use as a blocking control in assays to test for specificity of this SCOTIN antibody

Images

Western Blot analysis using SCOTIN antibody (70R-5982)

SCOTIN antibody (70R-5982) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SCOTIN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This protein can induce apoptosis in a caspase-dependent manner and plays a role in p53/TP53-dependent apoptosis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SCOTIN antibody (70R-5982) | SCOTIN antibody (70R-5982) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors