SDCBP2 antibody (70R-5903)

Rabbit polyclonal SDCBP2 antibody

Synonyms Polyclonal SDCBP2 antibody, Anti-SDCBP2 antibody, SDCBP2, SITAC18 antibody, Syntenin 2 antibody, FLJ12256 antibody, SDCBP-2, SDCBP 2, SDCBP 2 antibody, Syndecan Binding Protein antibody, SDCBP-2 antibody, ST-2 antibody
Cross Reactivity Human
Applications WB
Immunogen SDCBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQ
Assay Information SDCBP2 Blocking Peptide, catalog no. 33R-9432, is also available for use as a blocking control in assays to test for specificity of this SDCBP2 antibody

Images

Western Blot analysis using SDCBP2 antibody (70R-5903)

SDCBP2 antibody (70R-5903) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SDCBP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SDCBP2 contains 2 PDZ (DHR) domains. The function of SDCBP2 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SDCBP2 antibody (70R-5903) | SDCBP2 antibody (70R-5903) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors