SDHB antibody (70R-2436)

Rabbit polyclonal SDHB antibody

Synonyms Polyclonal SDHB antibody, Anti-SDHB antibody, Succinate Dehydrogenase Complex Subunit B Iron Sulfur antibody, SDHIP antibody, PGL4 antibody, IP antibody, SDH1 antibody, SDH antibody
Cross Reactivity Human,Mouse
Applications WB
Immunogen SDHB antibody was raised using a synthetic peptide corresponding to a region with amino acids YRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAE
Assay Information SDHB Blocking Peptide, catalog no. 33R-10234, is also available for use as a blocking control in assays to test for specificity of this SDHB antibody

Western Blot analysis using SDHB antibody (70R-2436)

SDHB antibody (70R-2436) used at 1 ug/ml to detect target protein.

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SDHB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. The iron-sulfur subunit is highly conserved and contains three cysteine-rich clusters which may comprise the iron-sulfur centers of the enzyme. Sporadic and familial mutations in this gene result in paragangliomas and pheochromocytoma, and support a link between mitochondrial dysfunction and tumorigenesis.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using SDHB antibody (70R-2436) | SDHB antibody (70R-2436) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors