Sec11c Blocking Peptide (33R-10422)

A synthetic peptide for use as a blocking control in assays to test for specificity of Sec11c antibody, catalog no. 70R-8863

Synonyms Sec11c control peptide, Sec11c antibody Blocking Peptide, Anti-Sec11c Blocking Peptide, SEC11 homolog C, S. cerevisiae Blocking Peptide, 1810029G24Rik Blocking Peptide, Sec11l3 Blocking Peptide, Sec11c, Secc-11, Secc 11, Secc-11 Blocking Peptide, Secc 11 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues VHRVIKVHEKDNGDIKFLTKGDNNEVDDRGLYKEGQNWLEKKDVVGRARG
Molecular Weight 22 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Sec11c is a component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors