SEC14L4 antibody (70R-3716)

Rabbit polyclonal SEC14L4 antibody

Synonyms Polyclonal SEC14L4 antibody, Anti-SEC14L4 antibody, SEC-14 antibody, TAP3 antibody, SEC 14 antibody, SEC-14, Sec14-Like 4 antibody, SEC14, SEC 14
Cross Reactivity Human,Mouse
Applications WB
Immunogen SEC14L4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSSRVGDLSPQQQEALARFRENLQDLLPILPNADDYFLLRWLRARNFDLQ
Assay Information SEC14L4 Blocking Peptide, catalog no. 33R-6510, is also available for use as a blocking control in assays to test for specificity of this SEC14L4 antibody

Images

Western Blot analysis using SEC14L4 antibody (70R-3716)

SEC14L4 antibody (70R-3716) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SEC14L4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SEC14L4 is a probable hydrophobic ligand-binding protein; may play a role in the transport of hydrophobic ligands like tocopherol, squalene and phospholipids.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SEC14L4 antibody (70R-3716) | SEC14L4 antibody (70R-3716) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors