SEC22C antibody (70R-6302)

Rabbit polyclonal SEC22C antibody

Synonyms Polyclonal SEC22C antibody, Anti-SEC22C antibody, SEC22L3 antibody, SEC 22, MGC5373 antibody, Sec22 Vesicle Trafficking Protein Homolog C antibody, DKFZp761F2321 antibody, SEC22, SEC-22, MGC13261 antibody, SEC 22 antibody, SEC-22 antibody
Cross Reactivity Human
Applications WB
Immunogen SEC22C antibody was raised using a synthetic peptide corresponding to a region with amino acids FRMEPVTALGILSLILNIMCAALNLIRGVHLAEHSLQVAHEEIGNILAFL
Assay Information SEC22C Blocking Peptide, catalog no. 33R-3053, is also available for use as a blocking control in assays to test for specificity of this SEC22C antibody

Images

Western Blot analysis using SEC22C antibody (70R-6302)

SEC22C antibody (70R-6302) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SEC22C antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the SEC22 family of vesicle trafficking proteins. It is localized at the endoplasmic reticulum and it is thought to play a role in the early stages of the ER-Golgi protein trafficking.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SEC22C antibody (70R-6302) | SEC22C antibody (70R-6302) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors