Secernin 2 antibody (70R-4388)

Rabbit polyclonal Secernin 2 antibody raised against the N terminal of SCRN2

Synonyms Polyclonal Secernin 2 antibody, Anti-Secernin 2 antibody, Secernin 2, Secernin -2 antibody, SCRN2 antibody, Secernin 2, Secernin 2 antibody, Secernin -2, Ses2 antibody
Specificity Secernin 2 antibody was raised against the N terminal of SCRN2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Secernin 2 antibody was raised using the N terminal of SCRN2 corresponding to a region with amino acids MASSSPDSPCSCDCFVSVPPASAIPAVIFAKNSDRPRDEVQEVVFVPAGT
Assay Information Secernin 2 Blocking Peptide, catalog no. 33R-5762, is also available for use as a blocking control in assays to test for specificity of this Secernin 2 antibody

Images

Western Blot analysis using Secernin 2 antibody (70R-4388)

Secernin 2 antibody (70R-4388) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SCRN2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of SCRN2 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Secernin 2 antibody (70R-4388) | Secernin 2 antibody (70R-4388) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors