SECTM1 antibody (70R-6758)

Rabbit polyclonal SECTM1 antibody raised against the middle region of SECTM1

Synonyms Polyclonal SECTM1 antibody, Anti-SECTM1 antibody, K12 antibody, SECTM 1, Secreted And Transmembrane 1 antibody, SECTM-1 antibody, SECTM-1, SECTM 1 antibody, SECTM1
Specificity SECTM1 antibody was raised against the middle region of SECTM1
Cross Reactivity Human
Applications WB
Immunogen SECTM1 antibody was raised using the middle region of SECTM1 corresponding to a region with amino acids ARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWPVPAVVTAV
Assay Information SECTM1 Blocking Peptide, catalog no. 33R-1467, is also available for use as a blocking control in assays to test for specificity of this SECTM1 antibody

Images

Western Blot analysis using SECTM1 antibody (70R-6758)

SECTM1 antibody (70R-6758) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SECTM1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SECTM1 antibody (70R-6758) | SECTM1 antibody (70R-6758) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors