SELS antibody (70R-5973)

Rabbit polyclonal SELS antibody raised against the middle region of SELS

Synonyms Polyclonal SELS antibody, Anti-SELS antibody, SEPS1 antibody, AD-015 antibody, VIMP antibody, ADO15 antibody, MGC2553 antibody, MGC104346 antibody, Selenoprotein S antibody, SBBI8 antibody
Specificity SELS antibody was raised against the middle region of SELS
Cross Reactivity Human
Applications WB
Immunogen SELS antibody was raised using the middle region of SELS corresponding to a region with amino acids PDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDS
Assay Information SELS Blocking Peptide, catalog no. 33R-7030, is also available for use as a blocking control in assays to test for specificity of this SELS antibody

Images

Western blot analysis using SELS antibody (70R-5973)

Recommended SELS Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SELS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SELS is a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Studies suggest that this protein may regulate cytokine production, and thus play a key role in the control of the inflammatory response.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using SELS antibody (70R-5973) | Recommended SELS Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors