SEMA6D antibody (70R-7127)

Rabbit polyclonal SEMA6D antibody raised against the N terminal of SEMA6D

Synonyms Polyclonal SEMA6D antibody, Anti-SEMA6D antibody, SEMAD 6, KIAA1479 antibody, SEMAD 6 antibody, SEMA6D, Sema Domain Immunoglobulin Domain 6D antibody, SEMAD-6, SEMAD-6 antibody, FLJ11598 antibody
Specificity SEMA6D antibody was raised against the N terminal of SEMA6D
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SEMA6D antibody was raised using the N terminal of SEMA6D corresponding to a region with amino acids KLYSATVADFLASDAVIYRSMGDGSALRTIKYDSKWIKEPHFLHAIEYGN
Assay Information SEMA6D Blocking Peptide, catalog no. 33R-4550, is also available for use as a blocking control in assays to test for specificity of this SEMA6D antibody

Images

Western Blot analysis using SEMA6D antibody (70R-7127)

SEMA6D antibody (70R-7127) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 65 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SEMA6D antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Semaphorins are a large family, including both secreted and membrane associated proteins, many of which have been implicated as inhibitors or chemorepellents in axon pathfinding, fasciculation and branching, and target selection. All semaphorins possess a semaphorin (Sema) domain and a PSI domain (found in plexins, semaphorins and integrins) in the N-terminal extracellular portion. Additional sequence motifs C-terminal to the semaphoring domain allow classification into distinct subfamilies. Results demonstrate that transmembrane semaphorins, like the secreted ones, can act as repulsive axon guidance cues. SEMA6D is a class 6 vertebrate transmembrane semaphorin that demonstrates alternative splicing. Six transcript variants have been identified and expression of the distinct encoded isoforms is thought to be regulated in a tissue- and development-dependent manner.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SEMA6D antibody (70R-7127) | SEMA6D antibody (70R-7127) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors