Semenogelin I antibody (70R-1587)

Rabbit polyclonal Semenogelin I antibody raised against the N terminal of SEMG1

Synonyms Polyclonal Semenogelin I antibody, Anti-Semenogelin I antibody, MGC14719 antibody, SGI antibody, SEMG antibody, SEMG1 antibody
Specificity Semenogelin I antibody was raised against the N terminal of SEMG1
Cross Reactivity Human
Applications IHC, WB
Immunogen Semenogelin I antibody was raised using the N terminal of SEMG1 corresponding to a region with amino acids QKGKQQTESKGSFSIQYTYHVDANDHDQSRKSQQYDLNALHKTTKSQRHL
Assay Information Semenogelin I Blocking Peptide, catalog no. 33R-7601, is also available for use as a blocking control in assays to test for specificity of this Semenogelin I antibody


Immunohistochemical staining using Semenogelin I antibody (70R-1587)

Semenogelin I antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar ceils (arrows) in Human Lung. Magnification is at 400X.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SEMG1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SEMG1 is the predominant protein in semen. The secreted protein is involved in the formation of a gel matrix that encases ejaculated spermatozoa. The prostate-specific antigen (PSA) protease processes this protein into smaller peptides, with each possibly having a separate function. The proteolysis process breaks down the gel matrix and allows the spermatozoa to move more freely.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using Semenogelin I antibody (70R-1587) | Semenogelin I antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar ceils (arrows) in Human Lung. Magnification is at 400X.
  • Western Blot analysis using Semenogelin I antibody (70R-1587) | Semenogelin I antibody (70R-1587) used at 1.25 ug/ml to detect target protein.
  • Immunohistochemical staining using Semenogelin I antibody (70R-1587) | Semenogelin I antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors