Semenogelin I antibody (70R-5491)

Rabbit polyclonal Semenogelin I antibody raised against the middle region of SEMG1

Synonyms Polyclonal Semenogelin I antibody, Anti-Semenogelin I antibody, SEMG antibody, MGC14719 antibody, SGI antibody, SEMG1 antibody
Specificity Semenogelin I antibody was raised against the middle region of SEMG1
Cross Reactivity Human
Applications WB
Immunogen Semenogelin I antibody was raised using the middle region of SEMG1 corresponding to a region with amino acids KDIFSTQDELLVYNKNQHQTKNLNQDQQHGRKANKISYQSSSTEERRLHY
Assay Information Semenogelin I Blocking Peptide, catalog no. 33R-4289, is also available for use as a blocking control in assays to test for specificity of this Semenogelin I antibody

Images

Western Blot analysis using Semenogelin I antibody (70R-5491)

Semenogelin I antibody (70R-5491) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SEMG1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SEMG1 is the predominant protein in semen. The secreted protein is involved in the formation of a gel matrix that encases ejaculated spermatozoa. The prostate-specific antigen (PSA) protease processes this protein into smaller peptides.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Semenogelin I antibody (70R-5491) | Semenogelin I antibody (70R-5491) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors