SEPHS1 antibody (70R-1203)

Rabbit polyclonal SEPHS1 antibody raised against the C terminal of SEPHS1

Synonyms Polyclonal SEPHS1 antibody, Anti-SEPHS1 antibody, SEPHS 1 antibody, SEPHS-1, SEPHS-1 antibody, SPS antibody, SPS1 antibody, SEPHS 1, SEPHS1, MGC4980 antibody, SELD antibody, Selenophosphate Synthetase 1 antibody
Specificity SEPHS1 antibody was raised against the C terminal of SEPHS1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SEPHS1 antibody was raised using the C terminal of SEPHS1 corresponding to a region with amino acids PKYGEGHQAWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGATS
Assay Information SEPHS1 Blocking Peptide, catalog no. 33R-7181, is also available for use as a blocking control in assays to test for specificity of this SEPHS1 antibody

Images

Western Blot analysis using SEPHS1 antibody (70R-1203)

SEPHS1 antibody (70R-1203) used at 5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SEPHS1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SEPHS1 is an enzyme that synthesizes selenophosphate from selenide and ATP. Selenophosphate is the selenium donor used to synthesize selenocysteine, which is co-translationally incorporated into selenoproteins at in-frame UGA codons.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SEPHS1 antibody (70R-1203) | SEPHS1 antibody (70R-1203) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors