Septin 9 antibody (70R-2210)
Rabbit polyclonal Septin 9 antibody raised against the C terminal of 40430
Overview
Overview
Synonyms | Polyclonal Septin 9 antibody, Anti-Septin 9 antibody, Septin -9, SINT1 antibody, 40057 antibody, KIAA0991 antibody, Septin 9, MSF antibody, SeptD1 antibody, PNUTL4 antibody, Septin 9, Septin -9 antibody, MSF1 antibody, AF17q25 antibody, Septin 9 antibody, NAPB antibody |
---|---|
Specificity | Septin 9 antibody was raised against the C terminal of 40430 |
Cross Reactivity | Human |
Applications | WB |
Immunogen | Septin 9 antibody was raised using the C terminal of 40430 corresponding to a region with amino acids HCEFAYLRDLLIRTHMQNIKDITSSIHFEAYRVKRLNEGSSAMANGMEEK |
Images
Western Blot analysis using Septin 9 antibody (70R-2210)
Septin 9 antibody (70R-2210) used at 0.5 ug/ml to detect target protein.
Specifications
Host | Rabbit |
---|---|
Method of Purification | Affinity purified |
Molecular Weight | 37 kDa (MW of target protein) |
Form & Buffer | Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of 40057 antibody in PBS |
Concentration | 1 mg/ml |
Usage & Assay Information
Usage Recommendations | WB: 0.5 ug/ml |
---|
Storage & Safety
Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
---|
General Information
Biological Significance | Septin-9 is a member of the septin family, which contains cytoplasmic cytoskeletal filament-forming proteins that have a conserved GTP-binding domain. |
---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product