Sequestosome 1 antibody (70R-5720)

Rabbit polyclonal Sequestosome 1 antibody raised against the middle region of SQSTM1

Synonyms Polyclonal Sequestosome 1 antibody, Anti-Sequestosome 1 antibody, Sequestosome -1, p60 antibody, Sequestosome -1 antibody, p62B antibody, OSIL antibody, PDB3 antibody, ZIP3 antibody, SQSTM1 antibody, Sequestosome 1 antibody, Sequestosome 1, Sequestosome 1, A170 antibody, p62 antibody
Specificity Sequestosome 1 antibody was raised against the middle region of SQSTM1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Sequestosome 1 antibody was raised using the middle region of SQSTM1 corresponding to a region with amino acids EEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPESEGPSSLDPSQE
Assay Information Sequestosome 1 Blocking Peptide, catalog no. 33R-2383, is also available for use as a blocking control in assays to test for specificity of this Sequestosome 1 antibody

Images

Western blot analysis using Sequestosome 1 antibody (70R-5720)

Recommended SQSTM1 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SQSTM1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a multifunctional protein that binds ubiquitin and regulates activation of the nuclear factor kappa-B (NF-kB) signaling pathway. The protein functions as a scaffolding/adaptor protein.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using Sequestosome 1 antibody (70R-5720) | Recommended SQSTM1 Antibody Titration: 0.2-1 ug/ml
  • Western blot analysis using Sequestosome 1 antibody (70R-5720) | Tissue analyzed: Human Fetal Lung; Antibody Dilution: 1.0ug/ml
  • Immunohistochemical staining using Sequestosome 1 antibody (70R-5720) | Pancreas
  • Western blot analysis using Sequestosome 1 antibody (70R-5720) | Tissue analyzed: Human Fetal Liver; Antibody Dilution: 1.0ug/ml
  • Western blot analysis using Sequestosome 1 antibody (70R-5720) | Tissue analyzed: Human Fetal Heart; Antibody Dilution: 1.0ug/ml

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors