SERBP1 antibody (70R-4695)

Rabbit polyclonal SERBP1 antibody raised against the C terminal of SERBP1

Synonyms Polyclonal SERBP1 antibody, Anti-SERBP1 antibody, Serpine mRNA Binding Protein 1 antibody, SERBP1, CGI-55 antibody, PAIRBP1 antibody, FLJ90489 antibody, DKFZp564M2423 antibody, CHD3IP antibody, SERBP-1 antibody, SERBP 1, PAI-RBP1 antibody, HABP4L antibody, SERBP 1 antibody, SERBP-1
Specificity SERBP1 antibody was raised against the C terminal of SERBP1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SERBP1 antibody was raised using the C terminal of SERBP1 corresponding to a region with amino acids DRAKVEFNIRKPNEGADGQWKKGFVLHKSKSEEAHAEDSVMDHHFRKPAN
Assay Information SERBP1 Blocking Peptide, catalog no. 33R-2138, is also available for use as a blocking control in assays to test for specificity of this SERBP1 antibody


Western blot analysis using SERBP1 antibody (70R-4695)

Recommended SERBP1 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SERBP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SERBP1 may play a role in the regulation of mRNA stability. It binds to the 3'-most 134 nt of the SERPINE1/PAI1 mRNA, a region which confers cyclic nucleotide regulation of message decay.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using SERBP1 antibody (70R-4695) | Recommended SERBP1 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors