SERBP1 antibody (70R-4696)

Rabbit polyclonal SERBP1 antibody raised against the middle region of SERBP1

Synonyms Polyclonal SERBP1 antibody, Anti-SERBP1 antibody, SERBP 1 antibody, SERBP 1, SERBP-1, CGI-55 antibody, Serpine mRNA Binding Protein 1 antibody, HABP4L antibody, PAI-RBP1 antibody, FLJ90489 antibody, SERBP1, CHD3IP antibody, DKFZp564M2423 antibody, PAIRBP1 antibody, SERBP-1 antibody
Specificity SERBP1 antibody was raised against the middle region of SERBP1
Cross Reactivity Human, Mouse, Rat, Dog
Applications WB
Immunogen SERBP1 antibody was raised using the middle region of SERBP1 corresponding to a region with amino acids SYNYSDLDQSNVTEETPEGEEHHPVADTENKENEVEEVKEEGPKEMTLDE
Assay Information SERBP1 Blocking Peptide, catalog no. 33R-8951, is also available for use as a blocking control in assays to test for specificity of this SERBP1 antibody

Images

Western blot analysis using SERBP1 antibody (70R-4696)

Recommended SERBP1 Antibody Titration: 0.125ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SERBP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.125 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SERBP1 may play a role in the regulation of mRNA stability. It binds to the 3'-most 134 nt of the SERPINE1/PAI1 mRNA, a region which confers cyclic nucleotide regulation of message decay.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using SERBP1 antibody (70R-4696) | Recommended SERBP1 Antibody Titration: 0.125ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors