Serglycin antibody (70R-5024)

Rabbit polyclonal Serglycin antibody raised against the middle region of SRGN

Synonyms Polyclonal Serglycin antibody, Anti-Serglycin antibody, FLJ12930 antibody, PPG antibody, PRG antibody, MGC9289 antibody, PRG1 antibody, SRGN antibody
Specificity Serglycin antibody was raised against the middle region of SRGN
Cross Reactivity Human
Applications WB
Immunogen Serglycin antibody was raised using the middle region of SRGN corresponding to a region with amino acids RTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDY
Assay Information Serglycin Blocking Peptide, catalog no. 33R-8219, is also available for use as a blocking control in assays to test for specificity of this Serglycin antibody

Images

Western Blot analysis using Serglycin antibody (70R-5024)

Serglycin antibody (70R-5024) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 15 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SRGN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SRGN is a protein best known as a hematopoietic cell granule proteoglycan. Proteoglycans stored in the secretory granules of many hematopoietic cells also contain a protease-resistant peptide core, which may be important for neutralizing hydrolytic enzymes. SRGN was found to be associated with the macromolecular complex of granzymes and perforin, which may serve as a mediator of granule-mediated apoptosis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Serglycin antibody (70R-5024) | Serglycin antibody (70R-5024) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors