SERINC2 antibody (70R-7034)

Rabbit polyclonal SERINC2 antibody raised against the N terminal of SERINC2

Synonyms Polyclonal SERINC2 antibody, Anti-SERINC2 antibody, SERINC-2, SERINC 2, TDE2L antibody, TDE2 antibody, FKSG84 antibody, PRO0899 antibody, Serine Incorporator 2 antibody, SERINC2, SERINC-2 antibody, MGC90340 antibody, SERINC 2 antibody
Specificity SERINC2 antibody was raised against the N terminal of SERINC2
Cross Reactivity Human
Applications WB
Immunogen SERINC2 antibody was raised using the N terminal of SERINC2 corresponding to a region with amino acids VCEEGAGIPTVLQGHIDCGSLLGYRAVYRMCFATAAFFFFFTLLMLCVSS
Assay Information SERINC2 Blocking Peptide, catalog no. 33R-9449, is also available for use as a blocking control in assays to test for specificity of this SERINC2 antibody

Images

Western Blot analysis using SERINC2 antibody (70R-7034)

SERINC2 antibody (70R-7034) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SERINC2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of SERINC2 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SERINC2 antibody (70R-7034) | SERINC2 antibody (70R-7034) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors