Serotonin receptor 2B antibody (70R-3768)

Rabbit polyclonal Serotonin receptor 2B antibody

Synonyms Polyclonal Serotonin receptor 2B antibody, Anti-Serotonin receptor 2B antibody, 5-Hydroxytryptamine antibody, 5-HT(2B) antibody, HTR2B antibody, 5-HT2B antibody
Cross Reactivity Human
Applications WB
Immunogen Serotonin receptor 2B antibody was raised using a synthetic peptide corresponding to a region with amino acids QTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKK
Assay Information Serotonin receptor 2B Blocking Peptide, catalog no. 33R-7748, is also available for use as a blocking control in assays to test for specificity of this Serotonin receptor 2B antibody


Western Blot analysis using Serotonin receptor 2B antibody (70R-3768)

Serotonin receptor 2B antibody (70R-3768) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HTR2B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Multiple receptor subtypes of serotonin neurotransmitters with multiple physiologic functions have been recognised. The 5-HT-2 receptors mediate many of the central and peripheral physiologic functions of serotonin. Cardiovascular effects include contraction of blood vessels and shape changes in platelets; central nervous system effects include neuronal sensitization to tactile stimuli and mediation of hallucinogenic effects of phenylisopropylamine hallucinogens.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Serotonin receptor 2B antibody (70R-3768) | Serotonin receptor 2B antibody (70R-3768) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors