Serotonin receptor 3E antibody (70R-5173)

Rabbit polyclonal Serotonin receptor 3E antibody

Synonyms Polyclonal Serotonin receptor 3E antibody , Anti-Serotonin receptor 3E antibody, MGC120037 antibody, MGC120036 antibody, MGC120035 antibody, HTR3E antibody, 5-Hydroxytryptamine antibody, 5-HT3c1 antibody
Cross Reactivity Human
Applications WB
Immunogen Serotonin receptor 3E antibody was raised using a synthetic peptide corresponding to a region with amino acids RWLHSLLLHCNSPGRCCPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPG
Assay Information Serotonin receptor 3E Blocking Peptide , catalog no. 33R-8266, is also available for use as a blocking control in assays to test for specificity of this Serotonin receptor 3E antibody

Images

Western Blot analysis using Serotonin receptor 3E antibody (70R-5173)

Serotonin receptor 3E antibody (70R-5173) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HTR3E antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HTR3E belongs to the ligand-gated ion channel receptor superfamily. HTR3E is a subunit E of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. Genes encoding subunits C, D and E form a cluster on chromosome 3. The product of this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes a subunit E of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. Genes encoding subunits C, D and E form a cluster on chromosome 3. An alternative splice variant has been described but its full length sequence has not been determined.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Serotonin receptor 3E antibody  (70R-5173) | Serotonin receptor 3E antibody (70R-5173) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors