SERPINA3 antibody (70R-5915)

Rabbit polyclonal SERPINA3 antibody raised against the middle region of SERPINA3

Synonyms Polyclonal SERPINA3 antibody, Anti-SERPINA3 antibody, SERPINA 3 antibody, MGC88254 antibody, GIG25 antibody, Serpin Peptidase Inhibitor Clade A Member 3 antibody, AACT antibody, SERPINA-3, ACT antibody, SERPINA 3, GIG24 antibody, SERPINA3, SERPINA-3 antibody
Specificity SERPINA3 antibody was raised against the middle region of SERPINA3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SERPINA3 antibody was raised using the middle region of SERPINA3 corresponding to a region with amino acids FRDEELSCTVVELKYTGNASALFILPDQDKMEEVEAMLLPETLKRWRDSL
Assay Information SERPINA3 Blocking Peptide, catalog no. 33R-3042, is also available for use as a blocking control in assays to test for specificity of this SERPINA3 antibody

Images

Western blot analysis using SERPINA3 antibody (70R-5915)

Recommended SERPINA3 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SERPINA3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SERPINA3 is a plasma protease inhibitor and member of the serine protease inhibitor class. Polymorphisms in this protein appear to be tissue specific and influence protease targeting. Variations in this protein's sequence have been implicated in Alzheimer's disease, and deficiency of this protein has been associated with liver disease.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using SERPINA3 antibody (70R-5915) | Recommended SERPINA3 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors