SERPINB1 antibody (70R-4130)

Rabbit polyclonal SERPINB1 antibody

Synonyms Polyclonal SERPINB1 antibody, Anti-SERPINB1 antibody, M/NEI antibody, PI2 antibody, SERPINB 1 antibody, Ovalbumin 1 antibody, Serpin Peptidase Inhibitor Clade B Member 1 antibody, ELANH2 antibody, SERPINB-1 antibody, SERPINB 1, MNEI antibody, LEI antibody, SERPINB-1, SERPINB1, EI antibody
Cross Reactivity Human
Applications WB
Immunogen SERPINB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENL
Assay Information SERPINB1 Blocking Peptide, catalog no. 33R-8251, is also available for use as a blocking control in assays to test for specificity of this SERPINB1 antibody


Western Blot analysis using SERPINB1 antibody (70R-4130)

SERPINB1 antibody (70R-4130) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SERPINB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SERPINB1 regulates the activity of the neutrophil proteases elastase, cathepsin G, proteinase-3, chymase, chymotrypsin, and kallikrein-3.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SERPINB1 antibody (70R-4130) | SERPINB1 antibody (70R-4130) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors