SERPINB13 antibody (70R-7068)

Rabbit polyclonal SERPINB13 antibody

Synonyms Polyclonal SERPINB13 antibody, Anti-SERPINB13 antibody, PI13 antibody, MGC126870 antibody, Serpin Peptidase Inhibitor Clade B Member 13 antibody, Ovalbumin 13 antibody, SERPINB-13 antibody, SERPINB-13, SERPINB 13 antibody, SERPINB13, HUR7 antibody, headpin antibody, SERPINB 13
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SERPINB13 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLFGEKTYLFLQKYLDYVEKYYHASLEPVDFVNAADESRKKINSWVESKT
Assay Information SERPINB13 Blocking Peptide, catalog no. 33R-8019, is also available for use as a blocking control in assays to test for specificity of this SERPINB13 antibody

Images

Western Blot analysis using SERPINB13 antibody (70R-7068)

SERPINB13 antibody (70R-7068) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SERPINB13 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SERPINB13 may play a role in the proliferation or differentiation of keratinocytes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SERPINB13 antibody (70R-7068) | SERPINB13 antibody (70R-7068) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors