SERPINB4 antibody (70R-4586)

Rabbit polyclonal SERPINB4 antibody

Synonyms Polyclonal SERPINB4 antibody, Anti-SERPINB4 antibody, SERPINB-4, PI11 antibody, LEUPIN antibody, Serpin Peptidase Inhibitor Clade B Member 4 antibody, SCCA2 antibody, SERPINB4, SERPINB 4 antibody, SERPINB 4, Ovalbumin 4 antibody, SERPINB-4 antibody, SCCA1 antibody, SCCA-2 antibody
Cross Reactivity Human
Applications WB
Immunogen SERPINB4 antibody was raised using a synthetic peptide corresponding to a region with amino acids TSALGMVLLGAKDNTAQQISKVLHFDQVTENTTEKAATYHVDRSGNVHHQ
Assay Information SERPINB4 Blocking Peptide, catalog no. 33R-9275, is also available for use as a blocking control in assays to test for specificity of this SERPINB4 antibody

Images

Western Blot analysis using SERPINB4 antibody (70R-4586)

SERPINB4 antibody (70R-4586) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SERPINB4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SERPINB4 may act as a protease inhibitor to modulate the host immune response against tumor cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SERPINB4 antibody (70R-4586) | SERPINB4 antibody (70R-4586) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors