SERPINC1 antibody (70R-5363)

Rabbit polyclonal SERPINC1 antibody

Synonyms Polyclonal SERPINC1 antibody, Anti-SERPINC1 antibody, AT3 antibody, MGC22579 antibody, Serpin Peptidase Inhibitor Clade C Member 1 antibody, ATIII antibody, SERPINC 1, SERPINC-1, Antithrombin 1 antibody, SERPINC1, SERPINC-1 antibody, SERPINC 1 antibody
Cross Reactivity Human
Applications WB
Immunogen SERPINC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQD
Assay Information SERPINC1 Blocking Peptide, catalog no. 33R-4150, is also available for use as a blocking control in assays to test for specificity of this SERPINC1 antibody

Images

Western Blot analysis using SERPINC1 antibody (70R-5363)

SERPINC1 antibody (70R-5363) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SERPINC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a plasma protease inhibitor and a member of the serpin superfamily. This protein inhibits thrombin as well as other activated serine proteases of the coagulation system, and it regulates the blood coagulation cascade.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SERPINC1 antibody (70R-5363) | SERPINC1 antibody (70R-5363) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors