SETDB2 antibody (70R-2104)

Rabbit polyclonal SETDB2 antibody raised against the N terminal of SETDB2

Synonyms Polyclonal SETDB2 antibody, Anti-SETDB2 antibody, SETDB-2 antibody, SETDB 2, Set Domain Bifurcated 2 antibody, SETDB-2, SETDB2, SETDB 2 antibody
Specificity SETDB2 antibody was raised against the N terminal of SETDB2
Cross Reactivity Human
Applications WB
Immunogen SETDB2 antibody was raised using the N terminal of SETDB2 corresponding to a region with amino acids ASQKEVNAQSSDPMPVTQKEQENKSNAFPSTSCENSFPEDCTFLTTGNKE
Assay Information SETDB2 Blocking Peptide, catalog no. 33R-1523, is also available for use as a blocking control in assays to test for specificity of this SETDB2 antibody

Images

Western Blot analysis using SETDB2 antibody (70R-2104)

SETDB2 antibody (70R-2104) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 77 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SETDB2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Proteins that contain a SET domain, such as SETDB2, modulate gene expression epigenetically through histone H3 methylation. SETDB2 is likely a histone H3 methyltransferase, as it contains both the active site and flanking cysteine residues required for catalytic activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SETDB2 antibody (70R-2104) | SETDB2 antibody (70R-2104) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors