SF3A1 antibody (70R-4828)

Rabbit polyclonal SF3A1 antibody raised against the N terminal of SF3A1

Synonyms Polyclonal SF3A1 antibody, Anti-SF3A1 antibody, SFA1-3 antibody, PRPF21 antibody, SFA1 3, Splicing Factor 3A Subunit 1 120Kda antibody, SAP114 antibody, SFA1-3, SF3A1, PRP21 antibody, SF3A120 antibody, SFA1 3 antibody
Specificity SF3A1 antibody was raised against the N terminal of SF3A1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SF3A1 antibody was raised using the N terminal of SF3A1 corresponding to a region with amino acids RQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQQ
Assay Information SF3A1 Blocking Peptide, catalog no. 33R-8124, is also available for use as a blocking control in assays to test for specificity of this SF3A1 antibody

Images

Western Blot analysis using SF3A1 antibody (70R-4828)

SF3A1 antibody (70R-4828) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 89 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SF3A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SF3A1 is the subunit 1 of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer includes subunits 1, 2 and 3 and is necessary for the in vitro conversion of 15S U2 snRNP into an active 17S particle that performs pre-mRNA splicing. Subunit 1 belongs to the SURP protein family; named for the SURP motifs that are thought to mediate RNA binding.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SF3A1 antibody (70R-4828) | SF3A1 antibody (70R-4828) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors