SF3B14 antibody (70R-4706)

Rabbit polyclonal SF3B14 antibody raised against the N terminal of SF3B14

Synonyms Polyclonal SF3B14 antibody, Anti-SF3B14 antibody, Ht006 antibody, CGI-110 antibody, SF3B14, SF3B14a antibody, Splicing Factor 3B 14 Kda Subunit antibody, SFB14-3 antibody, SFB14 3, HSPC175 antibody, SAP14 antibody, P14 antibody, SFB14 3 antibody, SFB14-3
Specificity SF3B14 antibody was raised against the N terminal of SF3B14
Cross Reactivity Human,Mouse
Applications WB
Immunogen SF3B14 antibody was raised using the N terminal of SF3B14 corresponding to a region with amino acids MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRV
Assay Information SF3B14 Blocking Peptide, catalog no. 33R-5703, is also available for use as a blocking control in assays to test for specificity of this SF3B14 antibody

Images

Western Blot analysis using SF3B14 antibody (70R-4706)

SF3B14 antibody (70R-4706) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 14 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SF3B14 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SF3B14 is a 14 kDa protein subunit of the splicing factor 3b complex. Splicing factor 3b associates with both the U2 and U11/U12 small nuclear ribonucleoprotein complexes (U2 snRNP) of spliceosomes. This 14 kDa protein interacts directly with subunit 1 of the splicing factor 3b complex. SF3B14 also interacts directly with the adenosine that carries out the first transesterification step of splicing at the pre-mRNA branch site.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SF3B14 antibody (70R-4706) | SF3B14 antibody (70R-4706) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors