SF3B14 antibody (70R-4707)

Rabbit polyclonal SF3B14 antibody raised against the middle region of SF3B14

Synonyms Polyclonal SF3B14 antibody, Anti-SF3B14 antibody, P14 antibody, CGI-110 antibody, SAP14 antibody, Ht006 antibody, SFB14-3 antibody, SFB14 3 antibody, SF3B14, SFB14 3, SFB14-3, Splicing Factor 3B 14 Kda Subunit antibody, HSPC175 antibody, SF3B14a antibody
Specificity SF3B14 antibody was raised against the middle region of SF3B14
Cross Reactivity Human,Mouse
Applications WB
Immunogen SF3B14 antibody was raised using the middle region of SF3B14 corresponding to a region with amino acids HLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK
Assay Information SF3B14 Blocking Peptide, catalog no. 33R-3788, is also available for use as a blocking control in assays to test for specificity of this SF3B14 antibody

Images

Western Blot analysis using SF3B14 antibody (70R-4707)

SF3B14 antibody (70R-4707) used at 2 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 14 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SF3B14 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SF3B14 is a 14 kDa protein subunit of the splicing factor 3b complex. Splicing factor 3b associates with both the U2 and U11/U12 small nuclear ribonucleoprotein complexes (U2 snRNP) of spliceosomes. This 14 kDa protein interacts directly with subunit 1 of the splicing factor 3b complex. SF3B14 also interacts directly with the adenosine that carries out the first transesterification step of splicing at the pre-mRNA branch site.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SF3B14 antibody (70R-4707) | SF3B14 antibody (70R-4707) used at 2 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors