SF3B3 antibody (70R-4646)

Rabbit polyclonal SF3B3 antibody raised against the middle region of SF3B3

Synonyms Polyclonal SF3B3 antibody, Anti-SF3B3 antibody, RSE1 antibody, SF3b130 antibody, STAF130 antibody, Splicing Factor 3B Subunit 3 130Kda antibody, SFB 3 antibody, SFB-3, KIAA0017 antibody, SFB-3 antibody, SF3B3, SFB 3, SAP130 antibody
Specificity SF3B3 antibody was raised against the middle region of SF3B3
Cross Reactivity Human
Applications WB
Immunogen SF3B3 antibody was raised using the middle region of SF3B3 corresponding to a region with amino acids TVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVI
Assay Information SF3B3 Blocking Peptide, catalog no. 33R-9341, is also available for use as a blocking control in assays to test for specificity of this SF3B3 antibody

Images

Western Blot analysis using SF3B3 antibody (70R-4646)

SF3B3 antibody (70R-4646) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 135 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SF3B3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SF3B3 is subunit 3 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SF3B3 antibody (70R-4646) | SF3B3 antibody (70R-4646) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors