SF3B4 antibody (70R-1408)

Rabbit polyclonal SF3B4 antibody raised against the N terminal of SF3B4

Synonyms Polyclonal SF3B4 antibody, Anti-SF3B4 antibody, SFB4-3, SF3B4, SFB4 3 antibody, SFB4 3, Splicing Factor 3B Subunit 4 49Kda antibody, SFB4-3 antibody
Specificity SF3B4 antibody was raised against the N terminal of SF3B4
Cross Reactivity Human,Mouse,Rat,Dog,ZebraFish
Applications IHC, WB
Immunogen SF3B4 antibody was raised using the N terminal of SF3B4 corresponding to a region with amino acids QDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVE
Assay Information SF3B4 Blocking Peptide, catalog no. 33R-7491, is also available for use as a blocking control in assays to test for specificity of this SF3B4 antibody


Immunohistochemical staining using SF3B4 antibody (70R-1408)

SF3B4 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SF3B4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SF3B4 is one of four subunits of the splicing factor 3B. The protein cross-links to a region in the pre-mRNA immediately upstream of the branchpoint sequence in pre-mRNA in the prespliceosomal complex A. It also may be involved in the assembly of the B, C and E spliceosomal complexes. In addition to RNA-binding activity, this protein interacts directly and highly specifically with subunit 2 of the splicing factor 3B. This protein contains two N-terminal RNA-recognition motifs (RRMs), consistent with the observation that it binds directly to pre-mRNA.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using SF3B4 antibody (70R-1408) | SF3B4 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X
  • Western Blot analysis using SF3B4 antibody (70R-1408) | SF3B4 antibody (70R-1408) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors