SFPQ antibody (70R-1422)

Rabbit polyclonal SFPQ antibody

Synonyms Polyclonal SFPQ antibody, Anti-SFPQ antibody, Splicing Factor Proline/Glutamine-Rich antibody, Polypyrimidine Tract Binding Protein Associated antibody
Cross Reactivity Human
Applications IHC, WB
Immunogen SFPQ antibody was raised using a synthetic peptide corresponding to a region with amino acids VPGPGPGPKQGPGPGGPKGGKMPGGPKPGGGPGLSTPGGHPKPPHRGGGE
Assay Information SFPQ Blocking Peptide, catalog no. 33R-9727, is also available for use as a blocking control in assays to test for specificity of this SFPQ antibody


Immunohistochemical staining using SFPQ antibody (70R-1422)

SFPQ antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Intestine. Magnification is at 400X.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 78 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SFPQ antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SFPQ is DNA- and RNA binding protein. It is essential pre-mRNA splicing factor required early in spliceosome formation and for splicing catalytic step II, probably as an heteromer with NONO. It binds to pre-mRNA in spliceosome C complex, and specifically binds to intronic polypyrimidine tracts. It interacts with U5 snRNA. It may be involved in a pre-mRNA coupled splicing and polyadenylation process as component of a snRNP-free complex with SNRPA/U1A.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using SFPQ antibody (70R-1422) | SFPQ antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Intestine. Magnification is at 400X.
  • Western Blot analysis using SFPQ antibody (70R-1422) | SFPQ antibody (70R-1422) used at 1.25 ug/ml to detect target protein.
  • Immunohistochemical staining using SFPQ antibody (70R-1422) | SFPQ antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Squamous epithelial cells (arrows) in Human Skin. Magnification is at 400X

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors