SFRP2 antibody (70R-3563)

Rabbit polyclonal SFRP2 antibody raised against the middle region of SFRP2

Synonyms Polyclonal SFRP2 antibody, Anti-SFRP2 antibody, SDF-5 antibody, SFRP2, SFRP-2 antibody, FRP-2 antibody, SARP1 antibody, Secreted Frizzled-Related Protein 2 antibody, SFRP 2, SFRP 2 antibody, SFRP-2
Specificity SFRP2 antibody was raised against the middle region of SFRP2
Cross Reactivity Human,Mouse,Dog
Applications WB
Immunogen SFRP2 antibody was raised using the middle region of SFRP2 corresponding to a region with amino acids DRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKN
Assay Information SFRP2 Blocking Peptide, catalog no. 33R-2142, is also available for use as a blocking control in assays to test for specificity of this SFRP2 antibody

Images

Western Blot analysis using SFRP2 antibody (70R-3563)

SFRP2 antibody (70R-3563) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SFRP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SFRP2 is a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. Methylation of this gene is a potential marker for the presence of colorectal cancer.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SFRP2 antibody (70R-3563) | SFRP2 antibody (70R-3563) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors